Lineage for d1ux4b_ (1ux4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014770Fold a.207: Formin homology 2 domain (FH2 domain) [101446] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2014771Superfamily a.207.1: Formin homology 2 domain (FH2 domain) [101447] (1 family) (S)
    automatically mapped to Pfam PF02181
  5. 2014772Family a.207.1.1: Formin homology 2 domain (FH2 domain) [101448] (2 protein domains)
  6. 2014773Protein Bni1 [101451] (1 species)
  7. 2014774Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101452] (3 PDB entries)
  8. 2014777Domain d1ux4b_: 1ux4 B: [100143]

Details for d1ux4b_

PDB Entry: 1ux4 (more details), 3.3 Å

PDB Description: crystal structures of a formin homology-2 domain reveal a tethered-dimer architecture
PDB Compounds: (B:) bni1 protein

SCOPe Domain Sequences for d1ux4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ux4b_ a.207.1.1 (B:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
prphkklkqlhwekldctdnsiwgtgkaekfaddlyekgvladlekafaareikslaske
fkitflsrdisqqfginlhmysslsvadlvkkilncdrdflqtpsvveflskseiievsv
nlarnyapystdwegvrnledakppekdpndlqradqiylqlmvnlesywgsrmraltvv
tsyereynellaklrkvdkavsalqesdnlrnvfnvilavgnfmndtskqaqgfklstlq
rltfikdttnsmtflnyvekivrlnypsfndflselepvldvvkvsieqlvndckdfsqs
ivnversveignlsdsskfhpldkvliktlpvlpearkkgdlledevkltimefeslmht
ygedsgdkfakisffkkfadfineykkaqaqnlaaeeeerlyikhkkive

SCOPe Domain Coordinates for d1ux4b_:

Click to download the PDB-style file with coordinates for d1ux4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ux4b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ux4a_