Lineage for d1u7vb_ (1u7v B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778064Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. 2778089Protein Smad4 tumor suppressor C-terminal domain [49881] (1 species)
  7. 2778090Species Human (Homo sapiens) [TaxId:9606] [49882] (6 PDB entries)
    Uniprot Q13485 314-546
  8. 2778099Domain d1u7vb_: 1u7v B: [107730]
    Other proteins in same PDB: d1u7va_, d1u7vc_

Details for d1u7vb_

PDB Entry: 1u7v (more details), 2.7 Å

PDB Description: Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
PDB Compounds: (B:) Mothers against decapentaplegic homolog 4

SCOPe Domain Sequences for d1u7vb_:

Sequence, based on SEQRES records: (download)

>d1u7vb_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
yikvfdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvd
dlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpq

Sequence, based on observed residues (ATOM records): (download)

>d1u7vb_ b.26.1.1 (B:) Smad4 tumor suppressor C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
yikvfdlrqchrqmqqqaataqaaaaaqigvddlrrlcilrmsfvkgwgpdyprqsiket
pcwieihlhralqlldevlhtmpiadpq

SCOPe Domain Coordinates for d1u7vb_:

Click to download the PDB-style file with coordinates for d1u7vb_.
(The format of our PDB-style files is described here.)

Timeline for d1u7vb_: