PDB entry 1u7v

View 1u7v on RCSB PDB site
Description: Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
Class: signaling protein
Keywords: Smad, TGF-beta, signal transduction, protein complex, phosphorylation, signaling protein
Deposited on 2004-08-04, released 2004-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.243
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mothers against decapentaplegic homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD2, MADH2, MADR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15796 (0-197)
      • modified residue (195)
      • modified residue (197)
    Domains in SCOPe 2.07: d1u7va_
  • Chain 'B':
    Compound: Mothers against decapentaplegic homolog 4
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD4, MADH4, DPC4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u7vb_
  • Chain 'C':
    Compound: Mothers against decapentaplegic homolog 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMAD2, MADH2, MADR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15796 (Start-197)
      • modified residue (195)
      • modified residue (197)
    Domains in SCOPe 2.07: d1u7vc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u7vA (A:)
    epafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtr
    rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
    faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
    dkvltqmgspsvrcssms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u7vB (B:)
    isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
    eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
    yikvfdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvd
    dlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7vB (B:)
    isnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrt
    eaierarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsa
    yikvfdlrqchrqmqqqaataqaaaaaqigvddlrrlcilrmsfvkgwgpdyprqsiket
    pcwieihlhralqlldevlhtmpiadpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u7vC (C:)
    epafwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtr
    rhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqe
    faallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwl
    dkvltqmgspsvrcssms
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u7vC (C:)
    afwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtrrh
    igrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqefa
    allaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwldk
    vltqmgspsvrcssms