Lineage for d1u7vc_ (1u7v C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. Family b.26.1.1: SMAD domain [49880] (5 proteins)
  6. Protein Smad2 MH2 domain [49883] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49884] (5 PDB entries)
  8. Domain d1u7vc_: 1u7v C: [107731]
    Other proteins in same PDB: d1u7vb_

Details for d1u7vc_

PDB Entry: 1u7v (more details), 2.7 Å

PDB Description: Crystal Structure of the phosphorylated Smad2/Smad4 heterotrimeric complex
PDB Compounds: (C:) Mothers against decapentaplegic homolog 2

SCOPe Domain Sequences for d1u7vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u7vc_ b.26.1.1 (C:) Smad2 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
afwcsiayyelnqrvgetfhasqpsltvdgftdpsnserfclgllsnvnrnatvemtrrh
igrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqefa
allaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwldk
vltqmgspsvrcssms

SCOPe Domain Coordinates for d1u7vc_ are not available.

Timeline for d1u7vc_:

Domains from other chains:
(mouse over for more information)
d1u7va_, d1u7vb_