Lineage for d1u07a_ (1u07 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685927Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 1685928Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) (S)
  5. 1685936Family d.212.1.2: TonB [64326] (1 protein)
    isolated domain can form different segment-swapped dimers depending on the fragment length
    automatically mapped to Pfam PF03544
  6. 1685937Protein TonB [64327] (1 species)
  7. 1685938Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
    Uniprot P02929 150-239
  8. 1685939Domain d1u07a_: 1u07 A: [112902]
    significant structural changes compared to shorter C-terminal fragments; monomer is structurally similar to the TolA domain

Details for d1u07a_

PDB Entry: 1u07 (more details), 1.13 Å

PDB Description: crystal structure of the 92-residue c-term. part of tonb with significant structural changes compared to shorter fragments
PDB Compounds: (A:) TonB protein

SCOPe Domain Sequences for d1u07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u07a_ d.212.1.2 (A:) TonB {Escherichia coli [TaxId: 562]}
asgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevkna
mrrwryepgkpgsgivvnilfkingtteiq

SCOPe Domain Coordinates for d1u07a_:

Click to download the PDB-style file with coordinates for d1u07a_.
(The format of our PDB-style files is described here.)

Timeline for d1u07a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1u07b_