SCOPe 2.05: Domain d1u07a_: 1u07 A:

Lineage for d1u07a_ (1u07 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families)

5. Family d.212.1.2: TonB [64326] (1 protein)
   isolated domain can form different segment-swapped dimers depending on the fragment length
   automatically mapped to Pfam PF03544

6. Protein TonB [64327] (1 species)

7. Species Escherichia coli [TaxId:562] [64328] (6 PDB entries)
   Uniprot P02929 150-239

8. Domain d1u07a_: 1u07 A: [112902]
   significant structural changes compared to shorter C-terminal fragments; monomer is structurally similar to the TolA domain

Details for d1u07a_

PDB Entry: 1u07, 1.13 Å

PDB Description: crystal structure of the 92-residue c-term. part of tonb with significant structural changes compared to shorter fragments

PDB Compounds: (A:) TonB protein

SCOPe Domain Sequences for d1u07a_:

Sequence; same for both SEQRES and ATOM records:

>d1u07a_ d.212.1.2 (A:) TonB {Escherichia coli [TaxId: 562]}
asgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevkna
mrrwryepgkpgsgivvnilfkingtteiq

Timeline for d1u07a_:

• d1u07a_ first appeared in SCOP 1.71
  
• d1u07a_ appears in SCOPe 2.04
  
• d1u07a_ appears in SCOPe 2.06
  
• d1u07a_ appears in the current release, SCOPe 2.08