Lineage for d1u07a_ (1u07 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616111Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 616112Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (2 families) (S)
  5. 616119Family d.212.1.2: TonB [64326] (1 protein)
    isolated domain can form different segment-swapped dimers depending on the fragment length
  6. 616120Protein TonB [64327] (1 species)
  7. 616121Species Escherichia coli [TaxId:562] [64328] (3 PDB entries)
  8. 616122Domain d1u07a_: 1u07 A: [112902]

Details for d1u07a_

PDB Entry: 1u07 (more details), 1.13 Å

PDB Description: crystal structure of the 92-residue c-term. part of tonb with significant structural changes compared to shorter fragments

SCOP Domain Sequences for d1u07a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u07a_ d.212.1.2 (A:) TonB {Escherichia coli}
asgpralsrnqpqyparaqalriegqvkvkfdvtpdgrvdnvqilsakpanmferevkna
mrrwryepgkpgsgivvnilfkingtteiq

SCOP Domain Coordinates for d1u07a_:

Click to download the PDB-style file with coordinates for d1u07a_.
(The format of our PDB-style files is described here.)

Timeline for d1u07a_:

616122
d1u07a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1u07b_