Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Plant peroxiredoxin [142379] (1 species) |
Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [142380] (1 PDB entry) Uniprot Q8S3L0 1-162 |
Domain d1tp9a1: 1tp9 A:1-162 [119306] Other proteins in same PDB: d1tp9b_, d1tp9c_, d1tp9d_ complexed with so4 |
PDB Entry: 1tp9 (more details), 1.62 Å
SCOPe Domain Sequences for d1tp9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]} mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl
Timeline for d1tp9a1: