Lineage for d1tp9a1 (1tp9 A:1-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877687Protein Plant peroxiredoxin [142379] (1 species)
  7. 2877688Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [142380] (1 PDB entry)
    Uniprot Q8S3L0 1-162
  8. 2877689Domain d1tp9a1: 1tp9 A:1-162 [119306]
    Other proteins in same PDB: d1tp9b_, d1tp9c_, d1tp9d_
    complexed with so4

Details for d1tp9a1

PDB Entry: 1tp9 (more details), 1.62 Å

PDB Description: PRX D (type II) from Populus tremula
PDB Compounds: (A:) peroxiredoxin

SCOPe Domain Sequences for d1tp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
mapiavgdvlpdgklayfdeqdqlqevsvhslvagkkvilfgvpgaftptcslkhvpgfi
ekagelkskgvteilcisvndpfvmkawaksypenkhvkfladgsatythalgleldlqe
kglgtrsrrfallvddlkvkaaniegggeftvssaedilkdl

SCOPe Domain Coordinates for d1tp9a1:

Click to download the PDB-style file with coordinates for d1tp9a1.
(The format of our PDB-style files is described here.)

Timeline for d1tp9a1: