Lineage for d1syxb1 (1syx B:25-86)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865481Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 865482Superfamily d.76.1: GYF domain [55277] (1 family) (S)
  5. 865483Family d.76.1.1: GYF domain [55278] (2 proteins)
    Pfam PF02213
  6. 865484Protein GYF domain from cd2bp2 protein [55279] (1 species)
  7. 865485Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)
  8. 865486Domain d1syxb1: 1syx B:25-86 [119081]
    Other proteins in same PDB: d1syxa1, d1syxc1, d1syxe1
    automatically matched to d1gyfa_

Details for d1syxb1

PDB Entry: 1syx (more details), 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex
PDB Compounds: (B:) CD2 antigen cytoplasmic tail-binding protein 2

SCOP Domain Sequences for d1syxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syxb1 d.76.1.1 (B:25-86) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

SCOP Domain Coordinates for d1syxb1:

Click to download the PDB-style file with coordinates for d1syxb1.
(The format of our PDB-style files is described here.)

Timeline for d1syxb1: