SCOP 1.75: Domain d1syxd1: 1syx D:25-86

Lineage for d1syxd1 (1syx D:25-86)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.76.1: GYF domain [55277] (1 family)

5. Family d.76.1.1: GYF domain [55278] (2 proteins)
   Pfam PF02213

6. Protein GYF domain from cd2bp2 protein [55279] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55280] (3 PDB entries)

8. Domain d1syxd1: 1syx D:25-86 [119083]
   Other proteins in same PDB: d1syxa1, d1syxc1, d1syxe1
   automatically matched to d1gyfa_

Details for d1syxd1

PDB Entry: 1syx, 2.35 Å

PDB Description: the crystal structure of a binary u5 snrnp complex

PDB Compounds: (D:) CD2 antigen cytoplasmic tail-binding protein 2

SCOP Domain Sequences for d1syxd1:

Sequence; same for both SEQRES and ATOM records:

>d1syxd1 d.76.1.1 (D:25-86) GYF domain from cd2bp2 protein {Human (Homo sapiens) [TaxId: 9606]}
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

Timeline for d1syxd1:

• d1syxd1 first appeared in SCOP 1.73
  
• d1syxd1 appears in SCOPe 2.01
  
• d1syxd1 appears in the current release, SCOPe 2.08, called d1syxd_