Lineage for d1sxda_ (1sxd A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770825Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 770849Protein GABP-alpha subunit [109867] (1 species)
  7. 770850Species Mouse (Mus musculus) [TaxId:10090] [109868] (1 PDB entry)
    Uniprot Q00422 168-254 # structure of the Ets domain (320-429) is also known ((46868))
  8. 770851Domain d1sxda_: 1sxd A: [106079]

Details for d1sxda_

PDB Entry: 1sxd (more details)

PDB Description: solution structure of the pointed (pnt) domain from mgabpa
PDB Compounds: (A:) GA repeat binding protein, alpha

SCOP Domain Sequences for d1sxda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxda_ a.60.1.1 (A:) GABP-alpha subunit {Mouse (Mus musculus) [TaxId: 10090]}
gshmaalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelc
slnqedffqrvprgeilwshlellrkyvlas

SCOP Domain Coordinates for d1sxda_:

Click to download the PDB-style file with coordinates for d1sxda_.
(The format of our PDB-style files is described here.)

Timeline for d1sxda_: