PDB entry 1sxd

View 1sxd on RCSB PDB site
Description: Solution Structure of the Pointed (PNT) Domain from mGABPa
Class: transcription, signaling protein
Keywords: alpha helical
Deposited on 2004-03-30, released 2004-09-21
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-21, with a file datestamp of 2007-06-04.
Experiment type: NMR14
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GA repeat binding protein, alpha
  Species: MUS MUSCULUS
  Gene: GABPA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00422 (4-90)
    • cloning artifact (0-3)
  Domains in SCOP 1.75: d1sxda_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxdA (A:)
  gshmaalegyrkeqerlgipydpihwstdqvlhwvvwvmkefsmtdidlttlnisgrelc
  slnqedffqrvprgeilwshlellrkyvlas