Lineage for d1sp9b2 (1sp9 B:202-437)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (15 PDB entries)
Uniprot P93836 33-428 ! Uniprot P93836 63-459
Domain d1sp9b2: 1sp9 B:202-437 [238537]
automated match to d1tg5a2
complexed with fe2
Details for d1sp9b2
PDB Entry: 1sp9 (more details), 3 Å
PDB Description: 4-Hydroxyphenylpyruvate Dioxygenase
PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenaseSCOPe Domain Sequences for d1sp9b2:
Sequence, based on SEQRES records: (download)
>d1sp9b2 d.32.1.3 (B:202-437) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyekt
Sequence, based on observed residues (ATOM records): (download)
>d1sp9b2 d.32.1.3 (B:202-437) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
flpgfervepldygirrldhavgnvpelgpaltyvagftgfhqfaeftsglnsavlasnd
emvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdf
mpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqiftkplgdrptifie
iiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyekt
SCOPe Domain Coordinates for d1sp9b2:
Click to download the PDB-style file with coordinates for d1sp9b2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sp9b2:
- d1sp9b2 first appeared in SCOPe 2.04
- d1sp9b2 appears in SCOPe 2.06
- d1sp9b2 appears in the current release, SCOPe 2.08
View in 3D
