Lineage for d1sp9b2 (1sp9 B:202-437)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942540Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2942578Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2942610Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (16 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. 2942636Domain d1sp9b2: 1sp9 B:202-437 [238537]
    automated match to d1tg5a2
    complexed with fe2

Details for d1sp9b2

PDB Entry: 1sp9 (more details), 3 Å

PDB Description: 4-Hydroxyphenylpyruvate Dioxygenase
PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d1sp9b2:

Sequence, based on SEQRES records: (download)

>d1sp9b2 d.32.1.3 (B:202-437) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
flpgfervedassfpldygirrldhavgnvpelgpaltyvagftgfhqfaeftaddvgta
esglnsavlasndemvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlr
emrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqif
tkplgdrptifieiiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyekt

Sequence, based on observed residues (ATOM records): (download)

>d1sp9b2 d.32.1.3 (B:202-437) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
flpgfervepldygirrldhavgnvpelgpaltyvagftgfhqfaeftsglnsavlasnd
emvllpinepvhgtkrksqiqtylehnegaglqhlalmsedifrtlremrkrssiggfdf
mpsppptyyqnlkkrvgdvlsddqikeceelgilvdrddqgtllqiftkplgdrptifie
iiqrvgcmmkdeegkayqsggcggfgkgnfselfksieeyekt

SCOPe Domain Coordinates for d1sp9b2:

Click to download the PDB-style file with coordinates for d1sp9b2.
(The format of our PDB-style files is described here.)

Timeline for d1sp9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sp9b1