Class a: All alpha proteins [46456] (285 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries) Uniprot Q9WX78 |
Domain d1smyf3: 1smy F:74-257 [105783] Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2 complexed with g4p, mg, zn |
PDB Entry: 1smy (more details), 2.7 Å
SCOPe Domain Sequences for d1smyf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smyf3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d1smyf3: