Lineage for d1smyf3 (1smy F:74-257)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507706Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1507707Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 1507708Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 1507724Protein Sigma70 [88948] (2 species)
  7. 1507727Species Thermus thermophilus [TaxId:274] [88949] (9 PDB entries)
    Uniprot Q9WX78
  8. 1507728Domain d1smyf3: 1smy F:74-257 [105783]
    Other proteins in same PDB: d1smya1, d1smya2, d1smyb1, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyk1, d1smyk2, d1smyl1, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2
    complexed with g4p, mg, zn

Details for d1smyf3

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (F:) principal sigma factor

SCOPe Domain Sequences for d1smyf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyf3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d1smyf3:

Click to download the PDB-style file with coordinates for d1smyf3.
(The format of our PDB-style files is described here.)

Timeline for d1smyf3: