| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (14 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d1smyl1: 1smy L:1-49,L:173-229 [105786] Other proteins in same PDB: d1smya2, d1smyb2, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk2, d1smyl2, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3 complexed with g4p, mg, zn |
PDB Entry: 1smy (more details), 2.7 Å
SCOPe Domain Sequences for d1smyl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smyl1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d1smyl1: