Lineage for d1smyk2 (1smy K:50-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684393Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1684408Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1684415Domain d1smyk2: 1smy K:50-172 [105785]
    Other proteins in same PDB: d1smya1, d1smyb1, d1smyc_, d1smyd_, d1smye_, d1smyf1, d1smyf2, d1smyf3, d1smyk1, d1smyl1, d1smym_, d1smyn_, d1smyo_, d1smyp1, d1smyp2, d1smyp3
    complexed with g4p, mg, zn

Details for d1smyk2

PDB Entry: 1smy (more details), 2.7 Å

PDB Description: Structural basis for transcription regulation by alarmone ppGpp
PDB Compounds: (K:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1smyk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smyk2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d1smyk2:

Click to download the PDB-style file with coordinates for d1smyk2.
(The format of our PDB-style files is described here.)

Timeline for d1smyk2: