Lineage for d1skye2 (1sky E:1-82)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408139Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2408210Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2408211Species Bacillus sp., strain ps3 [TaxId:1409] [88680] (1 PDB entry)
  8. 2408212Domain d1skye2: 1sky E:1-82 [26479]
    Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye3
    complexed with so4

Details for d1skye2

PDB Entry: 1sky (more details), 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3
PDB Compounds: (E:) f1-ATPase

SCOPe Domain Sequences for d1skye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]}
mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr
tiamastdglirgmevidtgap

SCOPe Domain Coordinates for d1skye2:

Click to download the PDB-style file with coordinates for d1skye2.
(The format of our PDB-style files is described here.)

Timeline for d1skye2: