Lineage for d1skyb3 (1sky B:96-371)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2477617Protein Central domain of alpha subunit of F1 ATP synthase [88774] (5 species)
  7. 2477618Species Bacillus sp., strain ps3 [TaxId:1409] [88777] (1 PDB entry)
  8. 2477619Domain d1skyb3: 1sky B:96-371 [32358]
    Other proteins in same PDB: d1skyb1, d1skyb2, d1skye1, d1skye2, d1skye3
    complexed with so4

Details for d1skyb3

PDB Entry: 1sky (more details), 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3
PDB Compounds: (B:) f1-ATPase

SCOPe Domain Sequences for d1skyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skyb3 c.37.1.11 (B:96-371) Central domain of alpha subunit of F1 ATP synthase {Bacillus sp., strain ps3 [TaxId: 1409]}
evpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrrsvheplqtgikaida
lvpigrgqreliigdrqtgktsvaidtiinqkdqnmiciyvaigqkestvatvvetlakh
gapdytivvtasasqpapllflapyagvamgeyfmimgkhvlvviddlskqaaayrqlsl
llrrppgreaypgdifylhsrlleraaklsdakgggsltalpfvetqagdisayiptnvi
sitdgqiflqsdlffsgvrpainaglsvsrvggaaq

SCOPe Domain Coordinates for d1skyb3:

Click to download the PDB-style file with coordinates for d1skyb3.
(The format of our PDB-style files is described here.)

Timeline for d1skyb3: