Class b: All beta proteins [48724] (180 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
Species Bacillus sp., strain ps3 [TaxId:1409] [88680] (1 PDB entry) |
Domain d1skye2: 1sky E:1-82 [26479] Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye1, d1skye3 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOPe Domain Sequences for d1skye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} mtrgrviqvmgpvvdvkfenghlpaiynalkiqhkarnenevdidltlevalhlgddtvr tiamastdglirgmevidtgap
Timeline for d1skye2: