Lineage for d1s95a_ (1s95 A:)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) 
different families of this superfamily are groupped in a single Pfam family, Pfam PF00149Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species) Species Human (Homo sapiens) [TaxId:9606] [111232] (10 PDB entries)
Uniprot P53041 176-499
Domain d1s95a_: 1s95 A: [105375]
complexed with mn, mpd, po4
Details for d1s95a_
PDB Entry: 1s95 (more details), 1.6 Å
PDB Description: structure of serine/threonine protein phosphatase 5
PDB Compounds: (A:) serine/threonine protein phosphatase 5SCOPe Domain Sequences for d1s95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmayantllqlgmm
SCOPe Domain Coordinates for d1s95a_:
Click to download the PDB-style file with coordinates for d1s95a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s95a_:
- d1s95a_ first appeared in SCOP 1.69
- d1s95a_ appears in SCOPe 2.03
- d1s95a_ appears in SCOPe 2.05
- d1s95a_ appears in the current release, SCOPe 2.08
View in 3D
