Lineage for d1s95a_ (1s95 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513496Family d.159.1.3: Protein serine/threonine phosphatase [56310] (4 proteins)
  6. 513521Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 513522Species Human (Homo sapiens) [TaxId:9606] [111232] (1 PDB entry)
  8. 513523Domain d1s95a_: 1s95 A: [105375]

Details for d1s95a_

PDB Entry: 1s95 (more details), 1.6 Å

PDB Description: structure of serine/threonine protein phosphatase 5

SCOP Domain Sequences for d1s95a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens)}
ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete
kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd
hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl
fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl
eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq
ftavphpnvkpmayantllqlgmm

SCOP Domain Coordinates for d1s95a_:

Click to download the PDB-style file with coordinates for d1s95a_.
(The format of our PDB-style files is described here.)

Timeline for d1s95a_: