Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries) Uniprot P53041 176-499 |
Domain d1s95a_: 1s95 A: [105375] complexed with mn, mpd, po4 |
PDB Entry: 1s95 (more details), 1.6 Å
SCOPe Domain Sequences for d1s95a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} ysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlkete kitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllypd hfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhggl fsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkafl eennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfhq ftavphpnvkpmayantllqlgmm
Timeline for d1s95a_: