Lineage for d1rh6b_ (1rh6 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696452Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 2696453Protein Excisionase Xis [89004] (1 species)
  7. 2696454Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
    Uniprot P03699 1-55
  8. 2696456Domain d1rh6b_: 1rh6 B: [104936]
    protein/DNA complex

Details for d1rh6b_

PDB Entry: 1rh6 (more details), 1.7 Å

PDB Description: bacteriophage lambda excisionase (xis)-dna complex
PDB Compounds: (B:) Excisionase

SCOPe Domain Sequences for d1rh6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh6b_ a.6.1.7 (B:) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl

SCOPe Domain Coordinates for d1rh6b_:

Click to download the PDB-style file with coordinates for d1rh6b_.
(The format of our PDB-style files is described here.)

Timeline for d1rh6b_:

2696456
d1rh6b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1rh6a_