PDB entry 1rh6

View 1rh6 on RCSB PDB site
Description: Bacteriophage Lambda Excisionase (Xis)-DNA Complex
Class: DNA binding protein/DNA
Keywords: Protein-DNA complex, DNA architectural protein, 'winged'-helix protein, phage excision, site-specific DNA recombination, DNA BINDING PROTEIN-DNA COMPLEX
Deposited on 2003-11-13, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Excisionase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-54)
      • engineered (27)
    Domains in SCOPe 2.08: d1rh6a_
  • Chain 'B':
    Compound: Excisionase
    Species: Enterobacteria phage lambda [TaxId:10710]
    Gene: Xis
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03699 (0-End)
      • engineered (27)
    Domains in SCOPe 2.08: d1rh6b_
  • Chain 'C':
    Compound: 5'-d(*cp*tp*ap*tp*gp*tp*ap*gp*tp*cp*tp*gp*tp*tp*g)-3'
  • Chain 'D':
    Compound: 5'-d(p*cp*ap*ap*cp*ap*gp*ap*cp*tp*ap*cp*ap*tp*ap*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rh6A (A:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rh6B (B:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rh6B (B:)
    myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.