SCOPe 2.08: Domain d1rh6a_: 1rh6 A:

Lineage for d1rh6a_ (1rh6 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.7: Excisionase-like [46891] (2 proteins)
   kinked C-terminal helix

6. Protein Excisionase Xis [89004] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
   Uniprot P03699 1-55

8. Domain d1rh6a_: 1rh6 A: [104935]
   protein/DNA complex

Details for d1rh6a_

PDB Entry: 1rh6, 1.7 Å

PDB Description: bacteriophage lambda excisionase (xis)-dna complex

PDB Compounds: (A:) Excisionase

SCOPe Domain Sequences for d1rh6a_:

Sequence; same for both SEQRES and ATOM records:

>d1rh6a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp

Timeline for d1rh6a_:

• d1rh6a_ first appeared in SCOP 1.69
  
• d1rh6a_ appears in SCOPe 2.07