![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
![]() | Superfamily f.19.1: Aquaporin-like [81338] (2 families) ![]() |
![]() | Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
![]() | Protein Aquaporin Z [103470] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103471] (6 PDB entries) |
![]() | Domain d1rc2a_: 1rc2 A: [97281] complexed with bgl |
PDB Entry: 1rc2 (more details), 2.5 Å
SCOPe Domain Sequences for d1rc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc2a_ f.19.1.1 (A:) Aquaporin Z {Escherichia coli [TaxId: 562]} mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd
Timeline for d1rc2a_: