PDB entry 1rc2

View 1rc2 on RCSB PDB site
Description: 2.5 Angstrom Resolution X-ray Structure of Aquaporin Z
Class: membrane protein
Keywords: aquaporin, membrane protein
Deposited on 2003-11-03, released 2003-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aquaporin Z
    Species: Escherichia coli [TaxId:562]
    Gene: AQPZ, BNIP, B0875, C1009, SF0832, S0873
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rc2a_
  • Chain 'B':
    Compound: Aquaporin Z
    Species: Escherichia coli [TaxId:562]
    Gene: AQPZ, BNIP, B0875, C1009, SF0832, S0873
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rc2b_
  • Heterogens: BGL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rc2A (A:)
    mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
    hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
    ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
    tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rc2B (B:)
    mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
    hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
    ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
    tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd