Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein ADP-ribosylation factor [52614] (15 species) |
Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (9 PDB entries) Uniprot P32889 |
Domain d1r8qa_: 1r8q A: [97243] Other proteins in same PDB: d1r8qe_, d1r8qf_ complexed with a sec7 domain complexed with afb, g3d, mg, zn |
PDB Entry: 1r8q (more details), 1.86 Å
SCOPe Domain Sequences for d1r8qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8qa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
Timeline for d1r8qa_: