Lineage for d1r5tc_ (1r5t C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166092Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2166093Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2166094Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 2166098Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 2166113Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry)
    Uniprot Q06549
  8. 2166116Domain d1r5tc_: 1r5t C: [104814]
    complexed with zn

Details for d1r5tc_

PDB Entry: 1r5t (more details), 2 Å

PDB Description: the crystal structure of cytidine deaminase cdd1, an orphan c to u editase from yeast
PDB Compounds: (C:) Cytidine deaminase

SCOPe Domain Sequences for d1r5tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5tc_ c.97.1.1 (C:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
rskvmtmgellpmafgpshl

SCOPe Domain Coordinates for d1r5tc_:

Click to download the PDB-style file with coordinates for d1r5tc_.
(The format of our PDB-style files is described here.)

Timeline for d1r5tc_: