Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.1: Cytidine deaminase [53928] (4 proteins) strand 5 is antiparallel to strand 4 |
Protein mono-domain cytidine deaminase [75327] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry) Uniprot Q06549 |
Domain d1r5tc_: 1r5t C: [104814] complexed with zn |
PDB Entry: 1r5t (more details), 2 Å
SCOPe Domain Sequences for d1r5tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5tc_ c.97.1.1 (C:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs rskvmtmgellpmafgpshl
Timeline for d1r5tc_: