SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1r5tc_ (1r5t C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2147805Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2147806Family c.97.1.1: Cytidine deaminase [53928] (4 protein domains)
    strand 5 is antiparallel to strand 4
  6. 2147810Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 2147825Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110764] (1 PDB entry)
    Uniprot Q06549
  8. 2147828Domain d1r5tc_: 1r5t C: [104814]
    complexed with zn

Details for d1r5tc_

PDB Entry: 1r5t (more details), 2 Å

PDB Description: The Crystal Structure of Cytidine Deaminase CDD1, an Orphan C to U editase from Yeast
PDB Compounds: (C:) Cytidine deaminase

SCOPe Domain Sequences for d1r5tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5tc_ c.97.1.1 (C:) mono-domain cytidine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvggiedrqlealkraalkacelsyspyshfrvgcsiltnndviftganvenasysncic
aersamiqvlmaghrsgwkcmvicgdsedqcvspcgvcrqfinefvvkdfpivmlnstgs
rskvmtmgellpmafgpshl

SCOPe Domain Coordinates for d1r5tc_:

Click to download the PDB-style file with coordinates for d1r5tc_.
(The format of our PDB-style files is described here.)

Timeline for d1r5tc_: