![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Pyruvate decarboxylase [52478] (3 species) rudiment domain with a variant fold, lacks FAD-binding |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52480] (2 PDB entries) |
![]() | Domain d1qpba1: 1qpb A:182-360 [31739] Other proteins in same PDB: d1qpba2, d1qpba3, d1qpbb2, d1qpbb3 complexed with mg, pym, tpp |
PDB Entry: 1qpb (more details), 2.4 Å
SCOPe Domain Sequences for d1qpba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpba1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qtpidmslkpndaesekevidtilvlikdaknpviladaccsrhdvkaetkklidltqfp afvtpmgkgsideqhpryggvyvgtlskpevkeavesadlilsvgallsdfntgsfsysy ktknivefhsdhmkirnatfpgvqmkfvlqklltaiadaakgykpvavpartpanaavp
Timeline for d1qpba1: