Lineage for d1qjga_ (1qjg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936381Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)
  8. 2936439Domain d1qjga_: 1qjg A: [38102]
    complexed with equ, so4

Details for d1qjga_

PDB Entry: 1qjg (more details), 2.3 Å

PDB Description: crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
PDB Compounds: (A:) Ketosteroid Isomerase

SCOPe Domain Sequences for d1qjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjga_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOPe Domain Coordinates for d1qjga_:

Click to download the PDB-style file with coordinates for d1qjga_.
(The format of our PDB-style files is described here.)

Timeline for d1qjga_: