Lineage for d1qjgc_ (1qjg C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162085Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2162086Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2162087Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)
  8. 2162149Domain d1qjgc_: 1qjg C: [38104]
    complexed with equ, so4

Details for d1qjgc_

PDB Entry: 1qjg (more details), 2.3 Å

PDB Description: crystal structure of delta5-3-ketosteroid isomerase from pseudomonas testosteroni in complex with equilenin
PDB Compounds: (C:) Ketosteroid Isomerase

SCOPe Domain Sequences for d1qjgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjgc_ d.17.4.3 (C:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
ihaga

SCOPe Domain Coordinates for d1qjgc_:

Click to download the PDB-style file with coordinates for d1qjgc_.
(The format of our PDB-style files is described here.)

Timeline for d1qjgc_: