PDB entry 1qjg

View 1qjg on RCSB PDB site
Description: Crystal structure of delta5-3-ketosteroid isomerase from Pseudomonas testosteroni in complex with equilenin
Class: isomerase
Keywords: ketosteroid isomerase, ksi, isomerase, steroid isomeration
Deposited on 1999-06-24, released 1999-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketosteroid Isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.08: d1qjga_
  • Chain 'B':
    Compound: Ketosteroid Isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.08: d1qjgb_
  • Chain 'C':
    Compound: Ketosteroid Isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.08: d1qjgc_
  • Chain 'D':
    Compound: Ketosteroid Isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.08: d1qjgd_
  • Chain 'E':
    Compound: Ketosteroid Isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.08: d1qjge_
  • Chain 'F':
    Compound: Ketosteroid Isomerase
    Species: PSEUDOMONAS TESTOSTERONI [TaxId:285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37)
      • conflict (82)
    Domains in SCOPe 2.08: d1qjgf_
  • Heterogens: EQU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjgA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjgB (B:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjgC (C:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjgD (D:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjgE (E:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qjgF (F:)
    mntpehmtavvqryvaalnagdldgivalfaddatvenpvgseprsgtaairefyanslk
    lplaveltqevravaneaafafivsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga