SCOPe 2.08: Domain d1q94a1: 1q94 A:182-275

Lineage for d1q94a1 (1q94 A:182-275)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class I MHC, alpha-3 domain [88604] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

Domain d1q94a1: 1q94 A:182-275 [104559]
Other proteins in same PDB: d1q94a2, d1q94b1, d1q94b2, d1q94d2, d1q94e1, d1q94e2

Details for d1q94a1

PDB Entry: 1q94 (more details), 2.4 Å

PDB Description: structures of hla-a*1101 in complex with immunodominant nonamer and decamer hiv-1 epitopes clearly reveal the presence of a middle anchor residue

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-11 alpha chain

SCOPe Domain Sequences for d1q94a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q94a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1q94a1:

Click to download the PDB-style file with coordinates for d1q94a1.
(The format of our PDB-style files is described here.)

Timeline for d1q94a1: