SCOP 1.69: Domain d1q94a1: 1q94 A:182-275

Lineage for d1q94a1 (1q94 A:182-275)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)

8. Domain d1q94a1: 1q94 A:182-275 [104559]
   Other proteins in same PDB: d1q94a2, d1q94b_, d1q94d2, d1q94e_

Details for d1q94a1

PDB Entry: 1q94, 2.4 Å

PDB Description: structures of hla-a*1101 in complex with immunodominant nonamer and decamer hiv-1 epitopes clearly reveal the presence of a middle anchor residue

SCOP Domain Sequences for d1q94a1:

Sequence; same for both SEQRES and ATOM records:

>d1q94a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwe

Timeline for d1q94a1:

• d1q94a1 is new in SCOP 1.69
  
• d1q94a1 appears in SCOP 1.71
  
• d1q94a1 appears in the current release, SCOPe 2.08