Lineage for d1ppna_ (1ppn A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926896Protein Papain [54005] (1 species)
  7. 2926897Species Papaya (Carica papaya) [TaxId:3649] [54006] (23 PDB entries)
  8. 2926905Domain d1ppna_: 1ppn A: [37004]
    complexed with moh, unl

Details for d1ppna_

PDB Entry: 1ppn (more details), 1.6 Å

PDB Description: structure of monoclinic papain at 1.60 angstroms resolution
PDB Compounds: (A:) papain

SCOPe Domain Sequences for d1ppna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppna_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

SCOPe Domain Coordinates for d1ppna_:

Click to download the PDB-style file with coordinates for d1ppna_.
(The format of our PDB-style files is described here.)

Timeline for d1ppna_: