Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein Papain [54005] (1 species) |
Species Papaya (Carica papaya) [TaxId:3649] [54006] (23 PDB entries) |
Domain d1ppna_: 1ppn A: [37004] complexed with moh, unl |
PDB Entry: 1ppn (more details), 1.6 Å
SCOPe Domain Sequences for d1ppna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppna_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg wgengyirikrgtgnsygvcglytssfypvkn
Timeline for d1ppna_: