PDB entry 1ppn

View 1ppn on RCSB PDB site
Description: structure of monoclinic papain at 1.60 angstroms resolution
Class: hydrolase(sulfhydryl proteinase)
Keywords: hydrolase(sulfhydryl proteinase)
Deposited on 1991-10-25, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ppna_
  • Heterogens: UNL, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppnA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
    llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn