Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily) consists of two non-similar domains, 3 layers (a/b/a) each Domain 1 has parallel beta-sheet of 6 strands, order 342156 Domain 2 has parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) |
Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins) Domain 2 binds ATP |
Protein Phosphoglycerate kinase [53750] (8 species) |
Species Bacillus stearothermophilus [TaxId:1422] [53752] (1 PDB entry) |
Domain d1phpa_: 1php A: [35452] complexed with adp, mg |
PDB Entry: 1php (more details), 1.65 Å
SCOPe Domain Sequences for d1phpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]} mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf gladkmdhistgggaslefmegkqlpgvvaledk
Timeline for d1phpa_: