Lineage for d1phpa_ (1php A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183841Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1183842Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1183843Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
  6. 1183844Protein Phosphoglycerate kinase [53750] (8 species)
  7. 1183845Species Bacillus stearothermophilus [TaxId:1422] [53752] (1 PDB entry)
  8. 1183846Domain d1phpa_: 1php A: [35452]
    complexed with adp, mg

Details for d1phpa_

PDB Entry: 1php (more details), 1.65 Å

PDB Description: structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms
PDB Compounds: (A:) 3-phosphoglycerate kinase

SCOPe Domain Sequences for d1phpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phpa_ c.86.1.1 (A:) Phosphoglycerate kinase {Bacillus stearothermophilus [TaxId: 1422]}
mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl
grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy
pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk
alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee
dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr
elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf
gladkmdhistgggaslefmegkqlpgvvaledk

SCOPe Domain Coordinates for d1phpa_:

Click to download the PDB-style file with coordinates for d1phpa_.
(The format of our PDB-style files is described here.)

Timeline for d1phpa_: