Lineage for d1php__ (1php -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily) Superfamily c.86.1: Phosphoglycerate kinase [53748] (1 family) 
Family c.86.1.1: Phosphoglycerate kinase [53749] (1 protein) Protein Phosphoglycerate kinase [53750] (4 species) 
Species Bacillus stearothermophilus [TaxId:1422] [53752] (1 PDB entry) 
Domain d1php__: 1php - [35452]
Details for d1php__
PDB Entry: 1php (more details), 1.65 Å
PDB Description: structure of the adp complex of the 3-phosphoglycerate kinase from bacillus stearothermophilus at 1.65 angstroms
SCOP Domain Sequences for d1php__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1php__ c.86.1.1 (-) Phosphoglycerate kinase {Bacillus stearothermophilus}
mnkktirdvdvrgkrvfcrvdfnvpmeqgaitddtriraalptiryliehgakvilashl
grpkgkvveelrldavakrlgellerpvaktneavgdevkaavdrlnegdvlllenvrfy
pgeekndpelakafaeladlyvndafgaahrahastegiahylpavagflmekelevlgk
alsnpdrpftaiiggakvkdkigvidnllekvdnliiggglaytfvkalghdvgksllee
dkielaksfmekakekgvrfympvdvvvadrfandantkvvpidaipadwsaldigpktr
elyrdviresklvvwngpmgvfemdafahgtkaiaealaealdtysvigggdsaaavekf
gladkmdhistgggaslefmegkqlpgvvaledk
SCOP Domain Coordinates for d1php__:
Click to download the PDB-style file with coordinates for d1php__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1php__:
- d1php__ appears in SCOP 1.57
- d1php__ appears in the current release, SCOPe 2.08, called d1phpa_
View in 3D