Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (1 family) common fold is elaborated with additional secondary structures |
Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
Protein Peptide methionine sulfoxide reductase [55070] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [89956] (1 PDB entry) |
Domain d1nwaa_: 1nwa A: [86295] |
PDB Entry: 1nwa (more details), 1.5 Å
SCOPe Domain Sequences for d1nwaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]} rhmtsnqkailaggcfwglqdlirnqpgvvstrvgysggnipnatyrnhgthaeaveiif dptvtdyrtllefffqihdpttkdrqgndrgtsyrsaifyfdeqqkrialdtiadveasg lwpgkvvtevspagdfweaepehqdylqrypngytchfvrpgwrlprr
Timeline for d1nwaa_: