| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
| Protein Peptide methionine sulfoxide reductase [55070] (4 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [89956] (1 PDB entry) |
| Domain d1nwaa1: 1nwa A:1-166 [86295] Other proteins in same PDB: d1nwaa2 |
PDB Entry: 1nwa (more details), 1.5 Å
SCOPe Domain Sequences for d1nwaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwaa1 d.58.28.1 (A:1-166) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]}
mtsnqkailaggcfwglqdlirnqpgvvstrvgysggnipnatyrnhgthaeaveiifdp
tvtdyrtllefffqihdpttkdrqgndrgtsyrsaifyfdeqqkrialdtiadveasglw
pgkvvtevspagdfweaepehqdylqrypngytchfvrpgwrlprr
Timeline for d1nwaa1: