Lineage for d1nwaa_ (1nwa A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029707Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 1029708Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (1 protein)
  6. 1029709Protein Peptide methionine sulfoxide reductase [55070] (3 species)
  7. 1029719Species Mycobacterium tuberculosis [TaxId:1773] [89956] (1 PDB entry)
  8. 1029720Domain d1nwaa_: 1nwa A: [86295]

Details for d1nwaa_

PDB Entry: 1nwa (more details), 1.5 Å

PDB Description: Structure of Mycobacterium tuberculosis Methionine Sulfoxide Reductase A in Complex with Protein-bound Methionine
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA

SCOPe Domain Sequences for d1nwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwaa_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mycobacterium tuberculosis [TaxId: 1773]}
rhmtsnqkailaggcfwglqdlirnqpgvvstrvgysggnipnatyrnhgthaeaveiif
dptvtdyrtllefffqihdpttkdrqgndrgtsyrsaifyfdeqqkrialdtiadveasg
lwpgkvvtevspagdfweaepehqdylqrypngytchfvrpgwrlprr

SCOPe Domain Coordinates for d1nwaa_:

Click to download the PDB-style file with coordinates for d1nwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1nwaa_: