Lineage for d1nexc1 (1nex C:116-186)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017816Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2017817Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2017818Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2017819Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 2017820Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (2 PDB entries)
  8. 2017824Domain d1nexc1: 1nex C:116-186 [80445]
    Other proteins in same PDB: d1nexa2, d1nexb1, d1nexb2, d1nexc2, d1nexd1, d1nexd2

Details for d1nexc1

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex
PDB Compounds: (C:) Centromere DNA-binding protein complex CBF3 subunit D

SCOPe Domain Sequences for d1nexc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nexc1 a.157.1.1 (C:116-186) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaairr

SCOPe Domain Coordinates for d1nexc1:

Click to download the PDB-style file with coordinates for d1nexc1.
(The format of our PDB-style files is described here.)

Timeline for d1nexc1: