Class a: All alpha proteins [46456] (289 folds) |
Fold a.158: F-box domain [81385] (1 superfamily) multihelical; interlocked heterodimer with the Skp1 dimerisation domain |
Superfamily a.158.1: F-box domain [81383] (1 family) |
Family a.158.1.1: F-box domain [81381] (4 proteins) |
Protein Cdc4 F-box and linker domains [81912] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81913] (2 PDB entries) |
Domain d1nexd1: 1nex D:270-369 [80447] Other proteins in same PDB: d1nexa1, d1nexa2, d1nexb2, d1nexc1, d1nexc2, d1nexd2 |
PDB Entry: 1nex (more details), 2.7 Å
SCOPe Domain Sequences for d1nexd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nexd1 a.158.1.1 (D:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk gfnslnlklsqkypklsqqdrlrlsflenifilknwynpk
Timeline for d1nexd1: