Class a: All alpha proteins [46456] (171 folds) |
Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) |
Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins) |
Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species) Suppressor of kinetochore protein 1,Scskp1 |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (1 PDB entry) |
Domain d1nexc1: 1nex C:116-186 [80445] Other proteins in same PDB: d1nexa2, d1nexb1, d1nexb2, d1nexc2, d1nexd1, d1nexd2 complexed with mse, tpo; mutant |
PDB Entry: 1nex (more details), 2.7 Å
SCOP Domain Sequences for d1nexc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nexc1 a.157.1.1 (C:116-186) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae)} vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd ftpeeeaairr
Timeline for d1nexc1: