Lineage for d1nexc1 (1nex C:116-186)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218697Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 218698Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 218699Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 218700Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 218701Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (1 PDB entry)
  8. 218703Domain d1nexc1: 1nex C:116-186 [80445]
    Other proteins in same PDB: d1nexa2, d1nexb1, d1nexb2, d1nexc2, d1nexd1, d1nexd2
    complexed with mse, tpo; mutant

Details for d1nexc1

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex

SCOP Domain Sequences for d1nexc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nexc1 a.157.1.1 (C:116-186) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae)}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaairr

SCOP Domain Coordinates for d1nexc1:

Click to download the PDB-style file with coordinates for d1nexc1.
(The format of our PDB-style files is described here.)

Timeline for d1nexc1: