Lineage for d1mnga1 (1mng A:1-92)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719058Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1719184Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1719307Species Thermus thermophilus [TaxId:274] [46621] (2 PDB entries)
  8. 1719308Domain d1mnga1: 1mng A:1-92 [15776]
    Other proteins in same PDB: d1mnga2, d1mngb2
    complexed with azi, mn

Details for d1mnga1

PDB Entry: 1mng (more details), 1.8 Å

PDB Description: structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus
PDB Compounds: (A:) manganese superoxide dismutase

SCOPe Domain Sequences for d1mnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnga1 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]}
pypfklpdlgypyealephidaktmeihhqkhhgayvtnlnaalekypylhgvevevllr
hlaalpqdiqtavrnnggghlnhslfwrlltp

SCOPe Domain Coordinates for d1mnga1:

Click to download the PDB-style file with coordinates for d1mnga1.
(The format of our PDB-style files is described here.)

Timeline for d1mnga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnga2