![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
![]() | Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
![]() | Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
![]() | Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56315] (4 PDB entries) |
![]() | Domain d1m63a_: 1m63 A: [78677] Other proteins in same PDB: d1m63b_, d1m63c_, d1m63f_, d1m63g_ complexed with ca, fe, zn |
PDB Entry: 1m63 (more details), 2.8 Å
SCOPe Domain Sequences for d1m63a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m63a_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} msepkaidpklsttdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesv alriitegasilrqeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyv drgyfsiecvlylwalkilypktlfllrgnhecrhlteyftfkqeckikyservydacmd afdclplaalmnqqflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfg nektqehfthntvrgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfp slitifsapnyldvynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgek vtemlvnvlnic
Timeline for d1m63a_: